Lineage for d2hgup1 (2hgu P:6-141)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2945283Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 2945348Family d.41.4.2: Ribosomal protein L16p [117888] (1 protein)
    Pfam PF00252
  6. 2945349Protein Ribosomal protein L16p [117889] (4 species)
  7. 2945389Species Thermus thermophilus [TaxId:274] [160197] (5 PDB entries)
  8. 2945394Domain d2hgup1: 2hgu P:6-141 [145383]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
    protein/RNA complex
    protein/RNA complex

Details for d2hgup1

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (P:) 50S ribosomal protein L16

SCOPe Domain Sequences for d2hgup1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgup1 d.41.4.2 (P:6-141) Ribosomal protein L16p {Thermus thermophilus [TaxId: 274]}
rmkyrkqqrgrlkgatkggdyvafgdyglvalepawitaqqieaarvamvrhfrrggkif
irifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealriaghkl
piktkivrrdaydeaq

SCOPe Domain Coordinates for d2hgup1:

Click to download the PDB-style file with coordinates for d2hgup1.
(The format of our PDB-style files is described here.)

Timeline for d2hgup1: