![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
![]() | Superfamily b.155.1: L21p-like [141091] (1 family) ![]() automatically mapped to Pfam PF00829 |
![]() | Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
![]() | Protein Ribosomal protein L21p [141093] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [158939] (15 PDB entries) Uniprot P60492 1-101 |
![]() | Domain d2b66v1: 2b66 V:5-98 [144961] Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66w1, d2b66x1, d2b66y1, d2b66z1 |
PDB Entry: 2b66 (more details), 5.9 Å
SCOPe Domain Sequences for d2b66v1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b66v1 b.155.1.1 (V:5-98) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]} iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg rgkkiyirkyksgvqyrrrtghrqnftaikilgi
Timeline for d2b66v1: