Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.301: L35p-like [143033] (1 superfamily) core: alpha-beta(3)-alpha; 2layers a/b |
Superfamily d.301.1: L35p-like [143034] (1 family) automatically mapped to Pfam PF01632 |
Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein) Pfam PF01632 |
Protein Ribosomal protein L35p [143036] (3 species) |
Species Thermus thermophilus [TaxId:274] [160057] (9 PDB entries) Uniprot P80341 1-64 |
Domain d2b6681: 2b66 8:2-64 [144958] Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1 |
PDB Entry: 2b66 (more details), 5.9 Å
SCOPe Domain Sequences for d2b6681:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b6681 d.301.1.1 (8:2-64) Ribosomal protein L35p {Thermus thermophilus [TaxId: 274]} pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm lpr
Timeline for d2b6681: