Lineage for d2b66n1 (2b66 N:4-141)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101403Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 2101404Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 2101405Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 2101406Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 2101487Species Thermus thermophilus [TaxId:274] [159473] (14 PDB entries)
    Uniprot P60488 1-139
  8. 2101499Domain d2b66n1: 2b66 N:4-141 [127963]
    Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1

Details for d2b66n1

PDB Entry: 2b66 (more details), 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400
PDB Compounds: (N:) 50S ribosomal protein L13

SCOPe Domain Sequences for d2b66n1:

Sequence, based on SEQRES records: (download)

>d2b66n1 c.21.1.1 (N:4-141) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlga

Sequence, based on observed residues (ATOM records): (download)

>d2b66n1 c.21.1.1 (N:4-141) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlpkkqrgreafesvrvylgnpydtlgeisetlga

SCOPe Domain Coordinates for d2b66n1:

Click to download the PDB-style file with coordinates for d2b66n1.
(The format of our PDB-style files is described here.)

Timeline for d2b66n1: