SCOPe 2.08: Domain d2b66k2: 2b66 K:8-70

Lineage for d2b66k2 (2b66 K:8-70)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)

7. Species Thermus thermophilus [TaxId:274] [160200] (17 PDB entries)
   Uniprot P36238 1-70! Uniprot P36238 2-68! Uniprot P36238 2-70

8. Domain d2b66k2: 2b66 K:8-70 [127962]
   Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1

Details for d2b66k2

PDB Entry: 2b66, 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400

PDB Compounds: (K:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2b66k2:

Sequence; same for both SEQRES and ATOM records:

>d2b66k2 d.47.1.1 (K:8-70) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fii

Timeline for d2b66k2:

• d2b66k2 first appeared in SCOP 1.73
  
• d2b66k2 appears in SCOPe 2.07