Lineage for d2b66w1 (2b66 W:2-110)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2948717Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 2948718Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 2948719Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 2948720Protein Ribosomal protein L22 [54845] (5 species)
  7. 2948821Species Thermus thermophilus [TaxId:274] [160267] (10 PDB entries)
  8. 2948829Domain d2b66w1: 2b66 W:2-110 [127967]
    Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66x1, d2b66y1, d2b66z1

Details for d2b66w1

PDB Entry: 2b66 (more details), 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400
PDB Compounds: (W:) 50S ribosomal protein L22

SCOPe Domain Sequences for d2b66w1:

Sequence, based on SEQRES records: (download)

>d2b66w1 d.55.1.1 (W:2-110) Ribosomal protein L22 {Thermus thermophilus [TaxId: 274]}
eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn
hdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek

Sequence, based on observed residues (ATOM records): (download)

>d2b66w1 d.55.1.1 (W:2-110) Ribosomal protein L22 {Thermus thermophilus [TaxId: 274]}
eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn
hdledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek

SCOPe Domain Coordinates for d2b66w1:

Click to download the PDB-style file with coordinates for d2b66w1.
(The format of our PDB-style files is described here.)

Timeline for d2b66w1: