Lineage for d2b66k1 (2b66 K:71-140)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695423Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2695424Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2695425Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2695516Species Thermus thermophilus [TaxId:274] [158350] (15 PDB entries)
    Uniprot P36238 70-139! Uniprot P36238 71-137
  8. 2695534Domain d2b66k1: 2b66 K:71-140 [127961]
    Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1

Details for d2b66k1

PDB Entry: 2b66 (more details), 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400
PDB Compounds: (K:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2b66k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b66k1 a.4.7.1 (K:71-140) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg
taksmgievv

SCOPe Domain Coordinates for d2b66k1:

Click to download the PDB-style file with coordinates for d2b66k1.
(The format of our PDB-style files is described here.)

Timeline for d2b66k1: