SCOPe 2.08: Domain d2b66i1: 2b66 I:56-149

Lineage for d2b66i1 (2b66 I:56-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
   alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta

4. Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family)
   automatically mapped to Pfam PF03948

5. Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)

6. Protein Ribosomal protein L9 C-domain [55655] (3 species)

7. Species Thermus thermophilus [TaxId:274] [143635] (9 PDB entries)
   Uniprot Q5SLQ1 55-146

8. Domain d2b66i1: 2b66 I:56-149 [127959]
   Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66v1, d2b66w1, d2b66x1, d2b66y1, d2b66z1

Details for d2b66i1

PDB Entry: 2b66, 5.9 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400

PDB Compounds: (I:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2b66i1:

Sequence, based on SEQRES records:

>d2b66i1 d.99.1.1 (I:56-149) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
rqaaeelanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrki
eladairalgytnvpvklhpevtatlkvhvteqk

Sequence, based on observed residues (ATOM records):

>d2b66i1 d.99.1.1 (I:56-149) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
rqaaeelanakklkeqlekltvtipakagegrlfgsitskqiaeslqaqhglkldkrkie
ladairalgytnvpvklhpevtatlkvhvteqk

Timeline for d2b66i1:

• d2b66i1 first appeared in SCOP 1.73
  
• d2b66i1 appears in SCOPe 2.07