| Class b: All beta proteins [48724] (174 folds) |
| Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
Superfamily b.155.1: L21p-like [141091] (1 family) ![]() |
| Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
| Protein Ribosomal protein L21p [141093] (3 species) |
| Species Deinococcus radiodurans [TaxId:1299] [158938] (10 PDB entries) Uniprot Q9RY64 5-98 |
| Domain d2b66v1: 2b66 V:5-98 [144961] Other proteins in same PDB: d2b6601, d2b6621, d2b6631, d2b6651, d2b6671, d2b6681, d2b6691, d2b66f1, d2b66h1, d2b66h2, d2b66i1, d2b66i2, d2b66k1, d2b66k2, d2b66n1, d2b66o1, d2b66r1, d2b66t1, d2b66u1, d2b66w1, d2b66x1, d2b66y1, d2b66z1 automatically matched to 2ZJR O:5-98 |
PDB Entry: 2b66 (more details), 5.9 Å
SCOP Domain Sequences for d2b66v1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b66v1 b.155.1.1 (V:5-98) Ribosomal protein L21p {Deinococcus radiodurans [TaxId: 1299]}
iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg
rgkkiyirkyksgvqyrrrtghrqnftaikilgi
Timeline for d2b66v1: