Class a: All alpha proteins [46456] (290 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.8: Proteasome activator [47216] (1 family) |
Family a.24.8.1: Proteasome activator [47217] (3 proteins) |
Protein automated matches [190828] (1 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188131] (7 PDB entries) |
Domain d1ya7q_: 1ya7 Q: [144610] Other proteins in same PDB: d1ya7a_, d1ya7b_, d1ya7c_, d1ya7d_, d1ya7e_, d1ya7f_, d1ya7g_, d1ya7h_, d1ya7i_, d1ya7j_, d1ya7k_, d1ya7l_, d1ya7m_, d1ya7n_, d1ya7o1 automated match to d1ya7o1 complexed with gol, so4 |
PDB Entry: 1ya7 (more details), 2.3 Å
SCOPe Domain Sequences for d1ya7q_:
Sequence, based on SEQRES records: (download)
>d1ya7q_ a.24.8.1 (Q:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel rqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs
>d1ya7q_ a.24.8.1 (Q:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk velatthlstmvravinayllnwkkliqprtgsdhmvs
Timeline for d1ya7q_: