Lineage for d1ya7r_ (1ya7 R:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700032Superfamily a.24.8: Proteasome activator [47216] (1 family) (S)
  5. 2700033Family a.24.8.1: Proteasome activator [47217] (3 proteins)
  6. 2700046Protein automated matches [190828] (1 species)
    not a true protein
  7. 2700047Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188131] (7 PDB entries)
  8. 2700057Domain d1ya7r_: 1ya7 R: [144611]
    Other proteins in same PDB: d1ya7a_, d1ya7b_, d1ya7c_, d1ya7d_, d1ya7e_, d1ya7f_, d1ya7g_, d1ya7h_, d1ya7i_, d1ya7j_, d1ya7k_, d1ya7l_, d1ya7m_, d1ya7n_, d1ya7o1
    automated match to d1ya7o1
    complexed with gol, so4

Details for d1ya7r_

PDB Entry: 1ya7 (more details), 2.3 Å

PDB Description: Implications for interactions of proteasome with PAN and PA700 from the 1.9 A structure of a proteasome-11S activator complex
PDB Compounds: (R:) proteasome activator protein PA26

SCOPe Domain Sequences for d1ya7r_:

Sequence, based on SEQRES records: (download)

>d1ya7r_ a.24.8.1 (R:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
rqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs

Sequence, based on observed residues (ATOM records): (download)

>d1ya7r_ a.24.8.1 (R:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
velatthlstmvravinayllnwkkliqprtgsdhmvs

SCOPe Domain Coordinates for d1ya7r_:

Click to download the PDB-style file with coordinates for d1ya7r_.
(The format of our PDB-style files is described here.)

Timeline for d1ya7r_: