Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Thermoplasma acidophilum [TaxId:2303] [186869] (4 PDB entries) |
Domain d1ya7n_: 1ya7 N: [122803] Other proteins in same PDB: d1ya7o1, d1ya7p_, d1ya7q_, d1ya7r_, d1ya7s_, d1ya7t_, d1ya7u_ automated match to d1pma1_ complexed with gol, so4 |
PDB Entry: 1ya7 (more details), 2.3 Å
SCOPe Domain Sequences for d1ya7n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ya7n_ d.153.1.4 (N:) automated matches {Thermoplasma acidophilum [TaxId: 2303]} tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr kdgyvqlptdqiesrirklglil
Timeline for d1ya7n_: