SCOPe 2.07: Domain d1ya7q_: 1ya7 Q:

Lineage for d1ya7q_ (1ya7 Q:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.8: Proteasome activator [47216] (1 family)

5. Family a.24.8.1: Proteasome activator [47217] (3 proteins)

6. Protein automated matches [190828] (1 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188131] (7 PDB entries)

8. Domain d1ya7q_: 1ya7 Q: [144610]
   Other proteins in same PDB: d1ya7a_, d1ya7b_, d1ya7c_, d1ya7d_, d1ya7e_, d1ya7f_, d1ya7g_, d1ya7h_, d1ya7i_, d1ya7j_, d1ya7k_, d1ya7l_, d1ya7m_, d1ya7n_, d1ya7o1
   automated match to d1ya7o1
   complexed with gol, so4

Details for d1ya7q_

PDB Entry: 1ya7, 2.3 Å

PDB Description: Implications for interactions of proteasome with PAN and PA700 from the 1.9 A structure of a proteasome-11S activator complex

PDB Compounds: (Q:) proteasome activator protein PA26

SCOPe Domain Sequences for d1ya7q_:

Sequence, based on SEQRES records:

>d1ya7q_ a.24.8.1 (Q:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
rqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs

Sequence, based on observed residues (ATOM records):

>d1ya7q_ a.24.8.1 (Q:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
velatthlstmvravinayllnwkkliqprtgsdhmvs

Timeline for d1ya7q_:

• d1ya7q_ first appeared in SCOP 1.75, called d1ya7q1
  
• d1ya7q_ appears in SCOPe 2.06
  
• d1ya7q_ appears in the current release, SCOPe 2.08