Class g: Small proteins [56992] (100 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein) automatically mapped to Pfam PF01246 |
Protein Ribosomal protein L24e [57750] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries) Uniprot P14116 |
Domain d2otlu1: 2otl U:4-56 [139366] Other proteins in same PDB: d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1 automatically matched to d1ffkr_ complexed with cd, cl, gir, k, mg, na |
PDB Entry: 2otl (more details), 2.7 Å
SCOPe Domain Sequences for d2otlu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otlu1 g.39.1.6 (U:4-56) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]} recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar
Timeline for d2otlu1:
View in 3D Domains from other chains: (mouse over for more information) d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1 |