SCOPe 2.08: Domain d2otlh1: 2otl H:1-171

Lineage for d2otlh1 (2otl H:1-171)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families)

5. Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)

6. Protein Ribosomal protein L10e [54688] (2 species)

7. Species Haloarcula marismortui [TaxId:2238] [54689] (58 PDB entries)
   Uniprot P60617

8. Domain d2otlh1: 2otl H:1-171 [139353]
   Other proteins in same PDB: d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
   automatically matched to d1s72h_
   complexed with cd, cl, gir, k, mg, na

Details for d2otlh1

PDB Entry: 2otl, 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui

PDB Compounds: (H:) 50S ribosomal protein L10e

SCOPe Domain Sequences for d2otlh1:

Sequence, based on SEQRES records:

>d2otlh1 d.41.4.1 (H:1-171) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki
vgtaarvqageqlftaycnvedaehvkeafrraynkitpscridsspagna

Sequence, based on observed residues (ATOM records):

>d2otlh1 d.41.4.1 (H:1-171) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage
qlftaycnvedaehvkeafrraynkitpscridsspagna

Timeline for d2otlh1:

• d2otlh1 first appeared in SCOP 1.73
  
• d2otlh1 appears in SCOPe 2.07