SCOPe 2.08: Domain d2otlc1: 2otl C:1-246

Lineage for d2otlc1 (2otl C:1-246)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family)
   automatically mapped to Pfam PF00573

5. Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)

6. Protein Ribosomal protein L4 [52168] (5 species)
   synonym: 50S ribosomal protein L4e, HMAL4, HL6

7. Species Haloarcula marismortui [TaxId:2238] [52170] (42 PDB entries)
   Uniprot P12735

8. Domain d2otlc1: 2otl C:1-246 [139348]
   Other proteins in same PDB: d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
   automatically matched to d1jj2c_
   complexed with cd, cl, gir, k, mg, na

Details for d2otlc1

PDB Entry: 2otl, 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui

PDB Compounds: (C:) 50S ribosomal protein L4P

SCOPe Domain Sequences for d2otlc1:

Sequence; same for both SEQRES and ATOM records:

>d2otlc1 c.22.1.1 (C:1-246) Ribosomal protein L4 {Haloarcula marismortui [TaxId: 2238]}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

Timeline for d2otlc1:

• d2otlc1 first appeared in SCOP 1.73
  
• d2otlc1 appears in SCOPe 2.07