Lineage for d2otl21 (2otl 2:1-49)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733645Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
    automatically mapped to Pfam PF00832
  5. 2733646Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 2733647Protein Ribosomal protein L39e [48664] (1 species)
  7. 2733648Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 2733683Domain d2otl21: 2otl 2:1-49 [145729]
    Other proteins in same PDB: d2otl11, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
    automatically matched to 1VQ4 2:1-49
    complexed with cd, cl, gir, k, mg, na

Details for d2otl21

PDB Entry: 2otl (more details), 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui
PDB Compounds: (2:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d2otl21:

Sequence, based on SEQRES records: (download)

>d2otl21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d2otl21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

SCOPe Domain Coordinates for d2otl21:

Click to download the PDB-style file with coordinates for d2otl21.
(The format of our PDB-style files is described here.)

Timeline for d2otl21: