SCOPe 2.08: Domain d2otlm1: 2otl M:1-194

Lineage for d2otlm1 (2otl M:1-194)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.2: L15e [54193] (1 protein)
   elaborated with additional structures
   automatically mapped to Pfam PF00827

6. Protein Ribosomal protein L15e [54194] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [54195] (42 PDB entries)
   Uniprot P60618

8. Domain d2otlm1: 2otl M:1-194 [139358]
   Other proteins in same PDB: d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
   automatically matched to d1s72m_
   complexed with cd, cl, gir, k, mg, na

Details for d2otlm1

PDB Entry: 2otl, 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui

PDB Compounds: (M:) 50S ribosomal protein L15e

SCOPe Domain Sequences for d2otlm1:

Sequence; same for both SEQRES and ATOM records:

>d2otlm1 d.12.1.2 (M:1-194) Ribosomal protein L15e {Haloarcula marismortui [TaxId: 2238]}
arsaysyirdawenpgdgqlaelqwqrqqewrnegaverierptrldkarsqgykakqgv
ivarvsvrkgsarkrrhkagrrskrqgvtritrrkdiqrvaeerasrtfpnlrvlnsysv
gqdgrqkwhevilidpnhpaiqndddlswicaddqadrvfrgltgagrrnrglsgkgkgs
ektrpslrsnggka

Timeline for d2otlm1:

• d2otlm1 first appeared in SCOP 1.73
  
• d2otlm1 appears in SCOPe 2.07