SCOPe 2.08: Domain d2otla2: 2otl A:1-90

Lineage for d2otla2 (2otl A:1-90)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries)
   Uniprot P20276
   includes the N-terminal tail

8. Domain d2otla2: 2otl A:1-90 [139346]
   Other proteins in same PDB: d2otl11, d2otl21, d2otl31, d2otla1, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
   automatically matched to d1s72a2
   complexed with cd, cl, gir, k, mg, na
   missing some secondary structures that made up less than one-third of the common domain

Details for d2otla2

PDB Entry: 2otl, 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui

PDB Compounds: (A:) 50S ribosomal protein L2P

SCOPe Domain Sequences for d2otla2:

Sequence; same for both SEQRES and ATOM records:

>d2otla2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvsaeiap

Timeline for d2otla2:

• d2otla2 first appeared in SCOP 1.73
  
• d2otla2 appears in SCOPe 2.07