Lineage for d2otla2 (2otl A:1-90)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668307Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 668391Protein N-terminal domain of ribosomal protein L2 [50299] (2 species)
    incomplete OB-fold lacking the last strand
  7. 668392Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries)
    includes the N-terminal tail
  8. 668410Domain d2otla2: 2otl A:1-90 [139346]
    Other proteins in same PDB: d2otl11, d2otl31, d2otla1, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
    automatically matched to d1s72a2
    complexed with 1ma, cd, cl, gir, k, mg, na, omg, omu, psu, ur3

Details for d2otla2

PDB Entry: 2otl (more details), 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui
PDB Compounds: (A:) 50S ribosomal protein L2P

SCOP Domain Sequences for d2otla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otla2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvsaeiap

SCOP Domain Coordinates for d2otla2:

Click to download the PDB-style file with coordinates for d2otla2.
(The format of our PDB-style files is described here.)

Timeline for d2otla2: