Lineage for d2otlu1 (2otl U:4-56)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750455Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
  6. 750456Protein Ribosomal protein L24e [57750] (1 species)
  7. 750457Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
  8. 750475Domain d2otlu1: 2otl U:4-56 [139366]
    Other proteins in same PDB: d2otl11, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
    automatically matched to d1ffkr_
    complexed with 1ma, cd, cl, gir, k, mg, na, omg, omu, psu, ur3

Details for d2otlu1

PDB Entry: 2otl (more details), 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui
PDB Compounds: (U:) 50S ribosomal protein L24e

SCOP Domain Sequences for d2otlu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otlu1 g.39.1.6 (U:4-56) Ribosomal protein L24e {Archaeon Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOP Domain Coordinates for d2otlu1:

Click to download the PDB-style file with coordinates for d2otlu1.
(The format of our PDB-style files is described here.)

Timeline for d2otlu1: