Lineage for d2iw5b1 (2iw5 B:376-440)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2304502Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2304761Family a.4.1.3: Myb/SANT domain [46739] (16 protein domains)
  6. 2304816Protein REST corepressor 1, CoREST [140165] (1 species)
  7. 2304817Species Human (Homo sapiens) [TaxId:9606] [140166] (23 PDB entries)
    Uniprot Q9UKL0 376-440
  8. 2304818Domain d2iw5b1: 2iw5 B:376-440 [137739]
    Other proteins in same PDB: d2iw5a1, d2iw5a2, d2iw5a3, d2iw5b2
    2nd SANT domain; in the PDB chain, also there is a coil coiled region N-terminally to this domain
    complexed with cl, fad, gol, nh4

Details for d2iw5b1

PDB Entry: 2iw5 (more details), 2.57 Å

PDB Description: structural basis for corest-dependent demethylation of nucleosomes by the human lsd1 histone demethylase
PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d2iw5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]}
iqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrrfnidevlq
eweae

SCOPe Domain Coordinates for d2iw5b1:

Click to download the PDB-style file with coordinates for d2iw5b1.
(The format of our PDB-style files is described here.)

Timeline for d2iw5b1: