SCOPe 2.08: Domain d2iw5b1: 2iw5 B:376-440

Lineage for d2iw5b1 (2iw5 B:376-440)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)

6. Protein REST corepressor 1, CoREST [140165] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140166] (23 PDB entries)
   Uniprot Q9UKL0 376-440

8. Domain d2iw5b1: 2iw5 B:376-440 [137739]
   Other proteins in same PDB: d2iw5a1, d2iw5a2, d2iw5a3, d2iw5b2
   2nd SANT domain; in the PDB chain, also there is a coil coiled region N-terminally to this domain
   complexed with cl, fad, gol, nh4
   has additional insertions and/or extensions that are not grouped together

Details for d2iw5b1

PDB Entry: 2iw5, 2.57 Å

PDB Description: structural basis for corest-dependent demethylation of nucleosomes by the human lsd1 histone demethylase

PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d2iw5b1:

Sequence; same for both SEQRES and ATOM records:

>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]}
iqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrrfnidevlq
eweae

Timeline for d2iw5b1:

• d2iw5b1 first appeared in SCOP 1.73
  
• d2iw5b1 appears in SCOPe 2.07