Lineage for d2iw5b1 (2iw5 B:376-440)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634287Superfamily a.4.1: Homeodomain-like [46689] (17 families) (S)
    consists only of helices
  5. 634507Family a.4.1.3: Myb/SANT domain [46739] (13 proteins)
  6. 634562Protein REST corepressor 1, CoREST [140165] (1 species)
  7. 634563Species Human (Homo sapiens) [TaxId:9606] [140166] (2 PDB entries)
  8. 634564Domain d2iw5b1: 2iw5 B:376-440 [137739]
    2nd SANT domain; in the PDB chain, also there is a coil coiled region N-terminally to this domain
    complexed with cl, fad, gol, nh4

Details for d2iw5b1

PDB Entry: 2iw5 (more details), 2.57 Å

PDB Description: structural basis for corest-dependent demethylation of nucleosomes by the human lsd1 histone demethylase
PDB Compounds: (B:) rest corepressor 1

SCOP Domain Sequences for d2iw5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]}
iqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrrfnidevlq
eweae

SCOP Domain Coordinates for d2iw5b1:

Click to download the PDB-style file with coordinates for d2iw5b1.
(The format of our PDB-style files is described here.)

Timeline for d2iw5b1: