| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.18: SWIRM domain [140222] (4 proteins) Pfam PF04433; contains extra N-terminal helix |
| Protein Lysine-specific histone demethylase 1, LSD1 [140227] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [140228] (28 PDB entries) Uniprot O60341 169-279 |
| Domain d2iw5a1: 2iw5 A:171-273 [145539] Other proteins in same PDB: d2iw5a2, d2iw5a3, d2iw5b1, d2iw5b2 complexed with cl, fad, gol, nh4 |
PDB Entry: 2iw5 (more details), 2.57 Å
SCOPe Domain Sequences for d2iw5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iw5a1 a.4.1.18 (A:171-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
psgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqlt
featlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl
Timeline for d2iw5a1: