SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2iw5a3 (2iw5 A:655-763)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161032Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2161033Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2161246Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 protein domains)
  6. 2161270Protein Lysine-specific histone demethylase 1, LSD1 [159953] (1 species)
  7. 2161271Species Human (Homo sapiens) [TaxId:9606] [159954] (27 PDB entries)
    Uniprot O60341 655-763
  8. 2161275Domain d2iw5a3: 2iw5 A:655-763 [145541]
    Other proteins in same PDB: d2iw5a1, d2iw5a2, d2iw5b1, d2iw5b2
    complexed with cl, fad, gol, nh4

Details for d2iw5a3

PDB Entry: 2iw5 (more details), 2.57 Å

PDB Description: structural basis for corest-dependent demethylation of nucleosomes by the human lsd1 histone demethylase
PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2iw5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iw5a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
gfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagi
menisddvivgrclailkgifgssavpqpketvvsrwradpwargsysy

SCOPe Domain Coordinates for d2iw5a3:

Click to download the PDB-style file with coordinates for d2iw5a3.
(The format of our PDB-style files is described here.)

Timeline for d2iw5a3: