SCOP 1.73: Domain d2hyfd2: 2hyf D:63-136

Lineage for d2hyfd2 (2hyf D:63-136)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family)

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)

6. Protein Manganese transport regulator MntR [89086] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries)

8. Domain d2hyfd2: 2hyf D:63-136 [136887]
   Other proteins in same PDB: d2hyfa1, d2hyfb1, d2hyfc1, d2hyfd1
   automatically matched to d1on1a2
   complexed with epe, so4

Details for d2hyfd2

PDB Entry: 2hyf, 2.8 Å

PDB Description: The Structure of apo-MntR from Bacillus subtilis, selenomethionine derivative

PDB Compounds: (D:) Transcriptional regulator mntR

SCOP Domain Sequences for d2hyfd2:

Sequence; same for both SEQRES and ATOM records:

>d2hyfd2 a.76.1.1 (D:63-136) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkk

Timeline for d2hyfd2:

• d2hyfd2 is new in SCOP 1.73
  
• d2hyfd2 appears in SCOP 1.75
  
• d2hyfd2 appears in the current release, SCOPe 2.08