Lineage for d2hyfc2 (2hyf C:63-136)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644361Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 644362Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) (S)
  5. 644363Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)
  6. 644421Protein Manganese transport regulator MntR [89086] (1 species)
  7. 644422Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries)
  8. 644442Domain d2hyfc2: 2hyf C:63-136 [136885]
    Other proteins in same PDB: d2hyfa1, d2hyfb1, d2hyfc1, d2hyfd1
    automatically matched to d1on1a2
    complexed with epe, so4

Details for d2hyfc2

PDB Entry: 2hyf (more details), 2.8 Å

PDB Description: The Structure of apo-MntR from Bacillus subtilis, selenomethionine derivative
PDB Compounds: (C:) Transcriptional regulator mntR

SCOP Domain Sequences for d2hyfc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyfc2 a.76.1.1 (C:63-136) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkk

SCOP Domain Coordinates for d2hyfc2:

Click to download the PDB-style file with coordinates for d2hyfc2.
(The format of our PDB-style files is described here.)

Timeline for d2hyfc2: