Lineage for d1on1a2 (1on1 A:63-136)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644361Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 644362Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) (S)
  5. 644363Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)
  6. 644421Protein Manganese transport regulator MntR [89086] (1 species)
  7. 644422Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries)
  8. 644429Domain d1on1a2: 1on1 A:63-136 [87100]
    Other proteins in same PDB: d1on1a1, d1on1b1

Details for d1on1a2

PDB Entry: 1on1 (more details), 1.75 Å

PDB Description: Bacillus Subtilis Manganese Transport Regulator (Mntr) Bound To Manganese, AB Conformation.
PDB Compounds: (A:) Transcriptional regulator mntR

SCOP Domain Sequences for d1on1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1on1a2 a.76.1.1 (A:63-136) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkk

SCOP Domain Coordinates for d1on1a2:

Click to download the PDB-style file with coordinates for d1on1a2.
(The format of our PDB-style files is described here.)

Timeline for d1on1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1on1a1