SCOP 1.73: Domain d2hyfd1: 2hyf D:3-62

Lineage for d2hyfd1 (2hyf D:3-62)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins)

6. Protein Manganese transport regulator MntR [88986] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [88987] (11 PDB entries)

8. Domain d2hyfd1: 2hyf D:3-62 [136886]
   Other proteins in same PDB: d2hyfa2, d2hyfb2, d2hyfc2, d2hyfd2
   automatically matched to d1on1a1
   complexed with epe, so4

Details for d2hyfd1

PDB Entry: 2hyf, 2.8 Å

PDB Description: The Structure of apo-MntR from Bacillus subtilis, selenomethionine derivative

PDB Compounds: (D:) Transcriptional regulator mntR

SCOP Domain Sequences for d2hyfd1:

Sequence; same for both SEQRES and ATOM records:

>d2hyfd1 a.4.5.24 (D:3-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
tpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl

Timeline for d2hyfd1:

• d2hyfd1 is new in SCOP 1.73
  
• d2hyfd1 appears in SCOP 1.75
  
• d2hyfd1 appears in the current release, SCOPe 2.08