PDB entry 2hyf

View 2hyf on RCSB PDB site
Description: The Structure of apo-MntR from Bacillus subtilis, selenomethionine derivative
Class: transcription
Keywords: transcriptional regulator
Deposited on 2006-08-06, released 2006-11-07
The last revision prior to the SCOP 1.73 freeze date was dated 2007-01-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.217
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54512
      • modified residue (5)
      • modified residue (14)
      • modified residue (41)
      • see remark 999 (80)
    Domains in SCOP 1.73: d2hyfa1, d2hyfa2
  • Chain 'B':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54512
      • modified residue (5)
      • modified residue (14)
      • modified residue (41)
      • see remark 999 (80)
    Domains in SCOP 1.73: d2hyfb1, d2hyfb2
  • Chain 'C':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54512
      • modified residue (5)
      • modified residue (14)
      • modified residue (41)
      • see remark 999 (80)
    Domains in SCOP 1.73: d2hyfc1, d2hyfc2
  • Chain 'D':
    Compound: Transcriptional regulator mntR
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54512
      • modified residue (5)
      • modified residue (14)
      • modified residue (41)
      • see remark 999 (80)
    Domains in SCOP 1.73: d2hyfd1, d2hyfd2
  • Heterogens: SO4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hyfA (A:)
    mttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrgl
    vltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyf
    eeddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hyfA (A:)
    tpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl
    tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
    ddarkkdlksiqkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hyfB (B:)
    mttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrgl
    vltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyf
    eeddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hyfB (B:)
    tpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliglvltskgk
    kigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfeeddark
    kdlksiq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hyfC (C:)
    mttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrgl
    vltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyf
    eeddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hyfC (C:)
    ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
    ltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfe
    eddarkkdlksiqkkte
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hyfD (D:)
    mttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrgl
    vltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyf
    eeddarkkdlksiqkktehhnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hyfD (D:)
    ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
    ltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfe
    eddarkkdlksiqkkte