Class a: All alpha proteins [46456] (258 folds) |
Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) |
Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins) |
Protein Manganese transport regulator MntR [89086] (1 species) |
Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries) |
Domain d2hyfb2: 2hyf B:63-134 [136883] Other proteins in same PDB: d2hyfa1, d2hyfb1, d2hyfc1, d2hyfd1 automatically matched to d1on1a2 complexed with epe, so4 |
PDB Entry: 2hyf (more details), 2.8 Å
SCOP Domain Sequences for d2hyfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hyfb2 a.76.1.1 (B:63-134) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee ddarkkdlksiq
Timeline for d2hyfb2: