![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins) |
![]() | Protein Manganese transport regulator MntR [88986] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [88987] (11 PDB entries) |
![]() | Domain d2hyfb1: 2hyf B:3-62 [136882] Other proteins in same PDB: d2hyfa2, d2hyfb2, d2hyfc2, d2hyfd2 automatically matched to d1on1a1 complexed with epe, so4 |
PDB Entry: 2hyf (more details), 2.8 Å
SCOP Domain Sequences for d2hyfb1:
Sequence, based on SEQRES records: (download)
>d2hyfb1 a.4.5.24 (B:3-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} tpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl
>d2hyfb1 a.4.5.24 (B:3-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} tpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliglvl
Timeline for d2hyfb1: