Lineage for d2hyfd2 (2hyf D:63-138)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718817Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2718818Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 2718819Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)
  6. 2718880Protein Manganese transport regulator MntR [89086] (1 species)
  7. 2718881Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries)
  8. 2718902Domain d2hyfd2: 2hyf D:63-138 [136887]
    Other proteins in same PDB: d2hyfa1, d2hyfb1, d2hyfc1, d2hyfd1
    automated match to d1on1a2
    complexed with epe, so4

Details for d2hyfd2

PDB Entry: 2hyf (more details), 2.8 Å

PDB Description: The Structure of apo-MntR from Bacillus subtilis, selenomethionine derivative
PDB Compounds: (D:) Transcriptional regulator mntR

SCOPe Domain Sequences for d2hyfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyfd2 a.76.1.1 (D:63-138) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkkte

SCOPe Domain Coordinates for d2hyfd2:

Click to download the PDB-style file with coordinates for d2hyfd2.
(The format of our PDB-style files is described here.)

Timeline for d2hyfd2: