Lineage for d2fsea1 (2fse A:82-181)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (808 PDB entries)
  8. 2353787Domain d2fsea1: 2fse A:82-181 [134017]
    Other proteins in same PDB: d2fsea2, d2fseb2, d2fsec2, d2fsed2
    automated match to d1fv1a1

Details for d2fsea1

PDB Entry: 2fse (more details), 3.1 Å

PDB Description: crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen
PDB Compounds: (A:) H-2 class II histocompatibility antigen, E-K alpha chain

SCOPe Domain Sequences for d2fsea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fsea1 b.1.1.2 (A:82-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itnvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefe

SCOPe Domain Coordinates for d2fsea1:

Click to download the PDB-style file with coordinates for d2fsea1.
(The format of our PDB-style files is described here.)

Timeline for d2fsea1: