SCOPe 2.08: Domain d2fsed1: 2fse D:93-189

Lineage for d2fsed1 (2fse D:93-189)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d2fsed1: 2fse D:93-189 [134023]
   Other proteins in same PDB: d2fsea2, d2fseb2, d2fsec2, d2fsed2
   automated match to d1sebb1

Details for d2fsed1

PDB Entry: 2fse, 3.1 Å

PDB Description: crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen

PDB Compounds: (D:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2fsed1:

Sequence; same for both SEQRES and ATOM records:

>d2fsed1 b.1.1.2 (D:93-189) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rrveptvtvyptktqplqhhnllvcsvsdfypgnievrwfrngkeeetgivstglvrngd
wtfqtlvmletvpqsgevytcqvehpsltdpvtvewk

Timeline for d2fsed1:

• d2fsed1 first appeared in SCOP 1.73
  
• d2fsed1 appears in SCOPe 2.07