Lineage for d2fsed1 (2fse D:93-189)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753378Domain d2fsed1: 2fse D:93-189 [134023]
    Other proteins in same PDB: d2fsea2, d2fseb2, d2fsec2, d2fsed2
    automated match to d1sebb1

Details for d2fsed1

PDB Entry: 2fse (more details), 3.1 Å

PDB Description: crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen
PDB Compounds: (D:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2fsed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fsed1 b.1.1.2 (D:93-189) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rrveptvtvyptktqplqhhnllvcsvsdfypgnievrwfrngkeeetgivstglvrngd
wtfqtlvmletvpqsgevytcqvehpsltdpvtvewk

SCOPe Domain Coordinates for d2fsed1:

Click to download the PDB-style file with coordinates for d2fsed1.
(The format of our PDB-style files is described here.)

Timeline for d2fsed1: