Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein automated matches [191280] (6 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [225821] (8 PDB entries) |
Domain d2fsed2: 2fse D:4-92 [134024] Other proteins in same PDB: d2fsea1, d2fseb1, d2fsec1, d2fsed1 automated match to d1klub2 |
PDB Entry: 2fse (more details), 3.1 Å
SCOPe Domain Sequences for d2fsed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fsed2 d.19.1.1 (D:4-92) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywns qkdlleqrraavdtycrhnygvgesftvq
Timeline for d2fsed2: