![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein automated matches [191280] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189896] (31 PDB entries) |
![]() | Domain d2fsec2: 2fse C:4-81 [134022] Other proteins in same PDB: d2fsea1, d2fseb1, d2fsec1, d2fsed1 automated match to d4h25a1 |
PDB Entry: 2fse (more details), 3.1 Å
SCOPe Domain Sequences for d2fsec2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fsec2 d.19.1.1 (C:4-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani avdkanleimtkrsnytp
Timeline for d2fsec2: