Lineage for d2fseb2 (2fse B:5-92)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. Protein automated matches [191280] (6 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [225821] (8 PDB entries)
  8. Domain d2fseb2: 2fse B:5-92 [134020]
    Other proteins in same PDB: d2fsea1, d2fseb1, d2fsec1, d2fsed1
    automated match to d1klub2

Details for d2fseb2

PDB Entry: 2fse (more details), 3.1 Å

PDB Description: crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2fseb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fseb2 d.19.1.1 (B:5-92) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
prflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywnsq
kdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d2fseb2 are not available.

Timeline for d2fseb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fseb1
View in 3D
Domains from other chains:
(mouse over for more information)
d2fsea1, d2fsea2, d2fsec1, d2fsec2, d2fsed1, d2fsed2