PDB entry 2fse

View 2fse on RCSB PDB site
Description: Crystallographic structure of a rheumatoid arthritis MHC susceptibility allele, HLA-DR1 (DRB1*0101), complexed with the immunodominant determinant of human type II collagen
Class: immune system, structural protein
Keywords: rheumatoid arthritis, HLA-DR1, collagen type II, antigen presentation, IMMUNE SYSTEM, STRUCTURAL PROTEIN
Deposited on 2006-01-22, released 2006-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class II histocompatibility antigen, E-K alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fsea1, d2fsea2
  • Chain 'B':
    Compound: HLA class II histocompatibility antigen, DRB1-1 beta chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fseb1, d2fseb2
  • Chain 'C':
    Compound: H-2 class II histocompatibility antigen, E-K alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fsec1, d2fsec2
  • Chain 'D':
    Compound: HLA class II histocompatibility antigen, DRB1-1 beta chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fsed1, d2fsed2
  • Chain 'E':
    Compound: Collagen alpha-1(II)
    Species: Homo sapiens [TaxId:9606]
    Gene: COL2A1
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Collagen alpha-1(II)
    Species: Homo sapiens [TaxId:9606]
    Gene: COL2A1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fseA (A:)
    ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
    avdkanleimtkrsnytpitnvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlr
    ngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwefe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fseB (B:)
    rprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywns
    qkdlleqrraavdtycrhnygvgesftvqrrveptvtvyptktqplqhhnllvcsvsdfy
    pgnievrwfrngkeeetgivstglvrngdwtfqtlvmletvpqsgevytcqvehpsltdp
    vtvewka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fseB (B:)
    prflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywnsq
    kdlleqrraavdtycrhnygvgesftvqrrveptvtvyptktqplqhhnllvcsvsdfyp
    gnievrwfrngkeeetgivstglvrngdwtfqtlvmletvpqsgevytcqvehpsltdpv
    tvewka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fseC (C:)
    ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
    avdkanleimtkrsnytpitnvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlr
    ngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwefe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fseC (C:)
    ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
    avdkanleimtkrsnytpitnvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlr
    ngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fseD (D:)
    rprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywns
    qkdlleqrraavdtycrhnygvgesftvqrrveptvtvyptktqplqhhnllvcsvsdfy
    pgnievrwfrngkeeetgivstglvrngdwtfqtlvmletvpqsgevytcqvehpsltdp
    vtvewka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fseD (D:)
    rprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywns
    qkdlleqrraavdtycrhnygvgesftvqrrveptvtvyptktqplqhhnllvcsvsdfy
    pgnievrwfrngkeeetgivstglvrngdwtfqtlvmletvpqsgevytcqvehpsltdp
    vtvewk
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.