SCOPe 2.08: Domain d2fsec1: 2fse C:82-180

Lineage for d2fsec1 (2fse C:82-180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d2fsec1: 2fse C:82-180 [134021]
   Other proteins in same PDB: d2fsea2, d2fseb2, d2fsec2, d2fsed2
   automated match to d1fv1a1

Details for d2fsec1

PDB Entry: 2fse, 3.1 Å

PDB Description: crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen

PDB Compounds: (C:) H-2 class II histocompatibility antigen, E-K alpha chain

SCOPe Domain Sequences for d2fsec1:

Sequence; same for both SEQRES and ATOM records:

>d2fsec1 b.1.1.2 (C:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itnvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwef

Timeline for d2fsec1:

• d2fsec1 first appeared in SCOP 1.73
  
• d2fsec1 appears in SCOPe 2.07