SCOPe 2.08: Domain d2fsea2: 2fse A:4-81

Lineage for d2fsea2 (2fse A:4-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries)

8. Domain d2fsea2: 2fse A:4-81 [134018]
   Other proteins in same PDB: d2fsea1, d2fseb1, d2fsec1, d2fsed1
   automated match to d4h25a1

Details for d2fsea2

PDB Entry: 2fse, 3.1 Å

PDB Description: crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen

PDB Compounds: (A:) H-2 class II histocompatibility antigen, E-K alpha chain

SCOPe Domain Sequences for d2fsea2:

Sequence; same for both SEQRES and ATOM records:

>d2fsea2 d.19.1.1 (A:4-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

Timeline for d2fsea2:

• d2fsea2 first appeared in SCOP 1.73
  
• d2fsea2 appears in SCOPe 2.07