Lineage for d2be5o_ (2be5 O:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1506616Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 1506617Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 1506618Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 1506619Protein RNA polymerase omega subunit [63564] (3 species)
  7. 1506637Species Thermus thermophilus [TaxId:274] [74729] (10 PDB entries)
    Uniprot Q8RQE7; part of multichain biological unit
  8. 1506643Domain d2be5o_: 2be5 O: [128367]
    Other proteins in same PDB: d2be5a1, d2be5a2, d2be5b1, d2be5b2, d2be5c_, d2be5d_, d2be5f1, d2be5f2, d2be5f3, d2be5k1, d2be5k2, d2be5l1, d2be5l2, d2be5m_, d2be5n_, d2be5p1, d2be5p2, d2be5p3
    automated match to d1iw7e_
    protein/RNA complex; complexed with mg, tgt, zn

Details for d2be5o_

PDB Entry: 2be5 (more details), 2.4 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with inhibitor tagetitoxin
PDB Compounds: (O:) RNA polymerase omega chain

SCOPe Domain Sequences for d2be5o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2be5o_ a.143.1.1 (O:) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

SCOPe Domain Coordinates for d2be5o_:

Click to download the PDB-style file with coordinates for d2be5o_.
(The format of our PDB-style files is described here.)

Timeline for d2be5o_: