| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) ![]() |
| Family a.4.13.1: Sigma3 domain [88660] (3 proteins) |
| Protein Sigma70 [88661] (1 species) |
| Species Thermus thermophilus [TaxId:274] [88662] (9 PDB entries) Uniprot Q9WX78 |
| Domain d2be5p1: 2be5 P:258-318 [128368] Other proteins in same PDB: d2be5a1, d2be5a2, d2be5b1, d2be5b2, d2be5c_, d2be5d_, d2be5e_, d2be5f2, d2be5f3, d2be5k1, d2be5k2, d2be5l1, d2be5l2, d2be5m_, d2be5n_, d2be5o_, d2be5p2, d2be5p3 automated match to d1smyf1 protein/RNA complex; complexed with mg, tgt, zn |
PDB Entry: 2be5 (more details), 2.4 Å
SCOPe Domain Sequences for d2be5p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2be5p1 a.4.13.1 (P:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e
Timeline for d2be5p1: