Lineage for d2be5l2 (2be5 L:50-172)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684390Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 1684391Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 1684392Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 1684393Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 1684408Species Thermus thermophilus [TaxId:274] [75595] (14 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 1684428Domain d2be5l2: 2be5 L:50-172 [128364]
    Other proteins in same PDB: d2be5a1, d2be5b1, d2be5c_, d2be5d_, d2be5e_, d2be5f1, d2be5f2, d2be5f3, d2be5k1, d2be5l1, d2be5m_, d2be5n_, d2be5o_, d2be5p1, d2be5p2, d2be5p3
    automated match to d1smya2
    protein/RNA complex; complexed with mg, tgt, zn

Details for d2be5l2

PDB Entry: 2be5 (more details), 2.4 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with inhibitor tagetitoxin
PDB Compounds: (L:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2be5l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2be5l2 d.181.1.1 (L:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOPe Domain Coordinates for d2be5l2:

Click to download the PDB-style file with coordinates for d2be5l2.
(The format of our PDB-style files is described here.)

Timeline for d2be5l2: