SCOPe 2.04: Domain d2be5l1: 2be5 L:1-49,L:173-229

Lineage for d2be5l1 (2be5 L:1-49,L:173-229)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75478] (14 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d2be5l1: 2be5 L:1-49,L:173-229 [128363]
   Other proteins in same PDB: d2be5a2, d2be5b2, d2be5c_, d2be5d_, d2be5e_, d2be5f1, d2be5f2, d2be5f3, d2be5k2, d2be5l2, d2be5m_, d2be5n_, d2be5o_, d2be5p1, d2be5p2, d2be5p3
   automated match to d1smya1
   protein/RNA complex; complexed with mg, tgt, zn

Details for d2be5l1

PDB Entry: 2be5, 2.4 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with inhibitor tagetitoxin

PDB Compounds: (L:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2be5l1:

Sequence; same for both SEQRES and ATOM records:

>d2be5l1 d.74.3.1 (L:1-49,L:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

Timeline for d2be5l1:

• d2be5l1 first appeared in SCOP 1.73
  
• d2be5l1 appears in SCOPe 2.03
  
• d2be5l1 appears in SCOPe 2.05
  
• d2be5l1 appears in the current release, SCOPe 2.08