Lineage for d2be5n_ (2be5 N:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1694801Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 1694802Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 1694889Family e.29.1.2: RNA-polymerase beta-prime [64490] (3 proteins)
  6. 1694919Protein RNA-polymerase beta-prime [64493] (2 species)
  7. 1694925Species Thermus thermophilus [TaxId:274] [75610] (13 PDB entries)
    Uniprot Q8RQE8; part of multichain biological unit
  8. 1694935Domain d2be5n_: 2be5 N: [128366]
    Other proteins in same PDB: d2be5a1, d2be5a2, d2be5b1, d2be5b2, d2be5c_, d2be5e_, d2be5f1, d2be5f2, d2be5f3, d2be5k1, d2be5k2, d2be5l1, d2be5l2, d2be5m_, d2be5o_, d2be5p1, d2be5p2, d2be5p3
    automated match to d1smyd_
    protein/RNA complex; complexed with mg, tgt, zn

Details for d2be5n_

PDB Entry: 2be5 (more details), 2.4 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with inhibitor tagetitoxin
PDB Compounds: (N:) DNA-directed RNA polymerase beta' chain

SCOPe Domain Sequences for d2be5n_:

Sequence, based on SEQRES records: (download)

>d2be5n_ e.29.1.2 (N:) RNA-polymerase beta-prime {Thermus thermophilus [TaxId: 274]}
kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
laelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivekg
qplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegarv
eagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdvl
adggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleem
khpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdln
dlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplr
sltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkm
eekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlv
egqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakp
srdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlky
vfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliq
ldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekk
qyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnply
vmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkgg
adtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradie
aglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvc
qkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvie
lfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyvea
gqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyvev
tdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasfq
ntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieearke
avea

Sequence, based on observed residues (ATOM records): (download)

>d2be5n_ e.29.1.2 (N:) RNA-polymerase beta-prime {Thermus thermophilus [TaxId: 274]}
kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
laelpepylfgdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgd
rvapgdvladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldleal
ekelleemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdgg
rfatsdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtn
pgsdrplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelf
kpfllkkmeekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgi
qafqpvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspa
sgeplakpsrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagre
tsvgrlkyvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavede
kvaweliqldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigidd
avipeekkqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfee
nypfnplyvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfis
shgarkggadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslr
lrkradieaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrsplt
cqtrygvcqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaadit
qglprvielfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllv
kdgdyveagqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvr
qmmkyvevtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstks
wlsaasfqntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlk
aieearkeavea

SCOPe Domain Coordinates for d2be5n_:

Click to download the PDB-style file with coordinates for d2be5n_.
(The format of our PDB-style files is described here.)

Timeline for d2be5n_: