Lineage for d2be5f2 (2be5 F:319-423)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1480774Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 1480807Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 1480815Protein Sigma70 (SigA, RpoD) [88666] (4 species)
  7. 1480826Species Thermus thermophilus [TaxId:274] [88667] (9 PDB entries)
    Uniprot Q9WX78
  8. 1480831Domain d2be5f2: 2be5 F:319-423 [128359]
    Other proteins in same PDB: d2be5a1, d2be5a2, d2be5b1, d2be5b2, d2be5c_, d2be5d_, d2be5e_, d2be5f1, d2be5f3, d2be5k1, d2be5k2, d2be5l1, d2be5l2, d2be5m_, d2be5n_, d2be5o_, d2be5p1, d2be5p3
    automated match to d1smyf2
    protein/RNA complex; complexed with mg, tgt, zn

Details for d2be5f2

PDB Entry: 2be5 (more details), 2.4 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with inhibitor tagetitoxin
PDB Compounds: (F:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d2be5f2:

Sequence, based on SEQRES records: (download)

>d2be5f2 a.4.13.2 (F:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld

Sequence, based on observed residues (ATOM records): (download)

>d2be5f2 a.4.13.2 (F:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
eevgaffgvtrerirqienkalrklkyhesrtrklrdfld

SCOPe Domain Coordinates for d2be5f2:

Click to download the PDB-style file with coordinates for d2be5f2.
(The format of our PDB-style files is described here.)

Timeline for d2be5f2: