| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) ![]() automatically mapped to Pfam PF01000 |
| Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins) |
| Protein RNA polymerase alpha subunit [56555] (3 species) |
| Species Thermus thermophilus [TaxId:274] [75595] (13 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
| Domain d2be5l2: 2be5 L:50-172 [128364] Other proteins in same PDB: d2be5a1, d2be5b1, d2be5c_, d2be5d_, d2be5e_, d2be5f1, d2be5f2, d2be5f3, d2be5k1, d2be5l1, d2be5m_, d2be5n_, d2be5o_, d2be5p1, d2be5p2, d2be5p3 automated match to d1smya2 protein/RNA complex; complexed with mg, tgt, zn |
PDB Entry: 2be5 (more details), 2.4 Å
SCOPe Domain Sequences for d2be5l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2be5l2 d.181.1.1 (L:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs
Timeline for d2be5l2: