Lineage for d1smya2 (1smy A:50-172)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1444704Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 1444705Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 1444706Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 1444707Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 1444722Species Thermus thermophilus [TaxId:274] [75595] (13 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 1444727Domain d1smya2: 1smy A:50-172 [105775]
    Other proteins in same PDB: d1smya1, d1smyb1, d1smyc_, d1smyd_, d1smye_, d1smyf1, d1smyf2, d1smyf3, d1smyk1, d1smyl1, d1smym_, d1smyn_, d1smyo_, d1smyp1, d1smyp2, d1smyp3
    complexed with g4p, mg, zn

Details for d1smya2

PDB Entry: 1smy (more details), 2.7 Å

PDB Description: Structural basis for transcription regulation by alarmone ppGpp
PDB Compounds: (A:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d1smya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smya2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOPe Domain Coordinates for d1smya2:

Click to download the PDB-style file with coordinates for d1smya2.
(The format of our PDB-style files is described here.)

Timeline for d1smya2: