| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins) 4 helices; irregular array |
| Protein RNA polymerase omega subunit [63564] (3 species) |
| Species Thermus thermophilus [TaxId:274] [74729] (10 PDB entries) Uniprot Q8RQE7; part of multichain biological unit |
| Domain d2be5o_: 2be5 O: [128367] Other proteins in same PDB: d2be5a1, d2be5a2, d2be5b1, d2be5b2, d2be5c_, d2be5d_, d2be5f1, d2be5f2, d2be5f3, d2be5k1, d2be5k2, d2be5l1, d2be5l2, d2be5m_, d2be5n_, d2be5p1, d2be5p2, d2be5p3 automated match to d1iw7e_ protein/RNA complex; complexed with mg, tgt, zn |
PDB Entry: 2be5 (more details), 2.4 Å
SCOPe Domain Sequences for d2be5o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2be5o_ a.143.1.1 (O:) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge
Timeline for d2be5o_: